Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM69 Rabbit Polyclonal Antibody (Biotin)

TRIM69 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Trif, HSD34, RNF36, HSD-34

UniProt

Q86WT6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM69

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EEF1E1 Protein, N-His
ARO-P10133-01 50 µg

Recombinant Human EEF1E1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human EEF1E1 Protein, N-His
ARO-P10133-02 100 µg

Recombinant Human EEF1E1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human EEF1E1 Protein, N-His
ARO-P10133-03 1 mg

Recombinant Human EEF1E1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1418930-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Imidazole glycerol phosphate synthase subunit HisH (hisH)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1418930-02 0.1 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Imidazole glycerol phosphate synthase subunit HisH (hisH)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1418930-03 0.02 mg (Yeast)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Imidazole glycerol phosphate synthase subunit HisH (hisH)

Sign In for Pricing
View Details