Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF36 Rabbit Polyclonal Antibody (HRP)

RNF36 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Trif, HSD34, RNF36, HSD-34

UniProt

Q8IYY3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF36

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_892030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)
abx317162-01 20 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)
abx317162-02 50 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)
abx317162-03 100 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)
abx317162-04 200 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)
abx317162-05 1 mg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (HRP)

Sign In for Pricing
View Details
DCTN4 Antibody, Biotin conjugated
CSB-PA892445LD01HU-01 50 µg

DCTN4 Antibody, Biotin conjugated

Sign In for Pricing
View Details