Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF36 Rabbit Polyclonal Antibody (Biotin)

RNF36 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Trif, HSD34, RNF36, HSD-34

UniProt

Q8IYY3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF36

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_892030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF11 (Growth Differentiation Factor 11, BMP-11, BMP11) (APC)
246530-APC 100 µL

GDF11 (Growth Differentiation Factor 11, BMP-11, BMP11) (APC)

Sign In for Pricing
View Details
MPP6 Protein Vector (Mouse) (pPB-C-His)
PV201718 500 ng

MPP6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human DPEP1 sgRNA gene knockout kit - Lentiviral human DPEP1 sgRNA gene knockout kit (100)
GTR15372961 1 Vial

Lentiviral human DPEP1 sgRNA gene knockout kit - Lentiviral human DPEP1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
SLC2A13 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb962960 100 µL

SLC2A13 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
SNX26 (Sorting Nexin 26, Sorting Nexin-26, SNX26 Protein, ARHGAP33, FLJ39019, NOMA-GAP, Rho GTPase Activating Protein 33, Rho-type GTPase-activating Protein 33, TC10/CDC42 GTPase-activating Protein, TCGAP) discontinued. See S1014-97T6
299531 100 µg

SNX26 (Sorting Nexin 26, Sorting Nexin-26, SNX26 Protein, ARHGAP33, FLJ39019, NOMA-GAP, Rho GTPase Activating Protein 33, Rho-type GTPase-activating Protein 33, TC10/CDC42 GTPase-activating Protein, TCGAP) discontinued. See S1014-97T6

Sign In for Pricing
View Details
Rheostats, Sliding Contact, Open Type, Single Tube
1090980/8B 1 Each

Rheostats, Sliding Contact, Open Type, Single Tube

Sign In for Pricing
View Details