Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmga1 Rabbit Polyclonal Antibody (HRP)

Hmga1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hmgi, Hmgiy

UniProt

Q8K585

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hmga1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_647543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A2 (ANXA2), Recombinant, Rat, His-Tag
054738-01 10 µg

Annexin A2 (ANXA2), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Annexin A2 (ANXA2), Recombinant, Rat, His-Tag
054738-02 50 µg

Annexin A2 (ANXA2), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Annexin A2 (ANXA2), Recombinant, Rat, His-Tag
054738-03 100 µg

Annexin A2 (ANXA2), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Annexin A2 (ANXA2), Recombinant, Rat, His-Tag
054738-04 200 µg

Annexin A2 (ANXA2), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Apolipoprotein L (APOL1) BioAssayTM ELISA Kit (Human)
023540 96 Tests

Apolipoprotein L (APOL1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
PE mouse TCRβ Antibody
orb3065341-01 25 Tests

PE mouse TCRβ Antibody

Sign In for Pricing
View Details