Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmga1 Rabbit Polyclonal Antibody (HRP)

Hmga1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hmgi, Hmgiy

UniProt

Q8K585

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hmga1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_647543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis C Virus NS5 (HCV) discontinued
H1920-27T 200 µg

Hepatitis C Virus NS5 (HCV) discontinued

Sign In for Pricing
View Details
HIV-1 p24
ant-152 0.5mg

HIV-1 p24

Sign In for Pricing
View Details
NOC3L Protein Vector (Rat) (pPB-C-His)
PV285566 500 ng

NOC3L Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Guinea Pig Immunoglobulin A ELISA kit
GTR10424693 96 Well

Guinea Pig Immunoglobulin A ELISA kit

Sign In for Pricing
View Details
Human Interleukin 1 Eta (IL1h) ELISA Kit
DL-IL1h-Hu-01 48 Tests

Human Interleukin 1 Eta (IL1h) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1 Eta (IL1h) ELISA Kit
DL-IL1h-Hu-02 96 Tests

Human Interleukin 1 Eta (IL1h) ELISA Kit

Sign In for Pricing
View Details