Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uhrf2 Rabbit Polyclonal Antibody (HRP)

Uhrf2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N, Nirf, AI426270, AW214556, 2310065A22Rik, D130071B19Rik

UniProt

Q7TMI3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659122

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Adipocyte Cell Complete Medium
CM-Rb199-01 100 mL

Rabbit Adipocyte Cell Complete Medium

Sign In for Pricing
View Details
Rabbit Adipocyte Cell Complete Medium
CM-Rb199-02 4x 125 mL

Rabbit Adipocyte Cell Complete Medium

Sign In for Pricing
View Details
Complete NCI-H358 Cell Medium with Serum and Supplements
C6683C 550 mL

Complete NCI-H358 Cell Medium with Serum and Supplements

Sign In for Pricing
View Details
Phospho-Bcl-xL (Ser62) Rabbit Polyclonal Antibody (BF647)
orb2461589 100 µL

Phospho-Bcl-xL (Ser62) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
PCDHA6 Human Over-expression Lysate
orb1370006 20 µg

PCDHA6 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Allochromatium vinosum Ribulose bisphosphate carboxylase small chain 2 (cbbS2)
MBS1108343-01 0.02 mg (E-Coli)

Recombinant Allochromatium vinosum Ribulose bisphosphate carboxylase small chain 2 (cbbS2)

Sign In for Pricing
View Details