Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uhrf2 Rabbit Polyclonal Antibody (Biotin)

Uhrf2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

N, Nirf, AI426270, AW214556, 2310065A22Rik, D130071B19Rik

UniProt

Q7TMI3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659122

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SynDIG3/Tmem91 Antibody FL594 Conjugate
75-186-FL594 200 µL

Anti-SynDIG3/Tmem91 Antibody FL594 Conjugate

Sign In for Pricing
View Details
Human TIM-3 HEK293 Overexpression Lysate
MBS8113811-01 0.3 mg

Human TIM-3 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human TIM-3 HEK293 Overexpression Lysate
MBS8113811-02 5x 0.3 mg

Human TIM-3 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 200 (CD200)
MBS2169126-01 0.1 mL

FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 200 (CD200)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 200 (CD200)
MBS2169126-02 0.2 mL

FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 200 (CD200)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 200 (CD200)
MBS2169126-03 0.5 mL

FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 200 (CD200)

Sign In for Pricing
View Details