Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thra Rabbit Polyclonal Antibody (Biotin)

Thra Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERBA1, Thra1, c-erbA-1

UniProt

P63059

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001017960

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A12 siRNA (Human)
CRJ6486-01 15 nmol

SLC39A12 siRNA (Human)

Sign In for Pricing
View Details
SLC39A12 siRNA (Human)
CRJ6486-02 30 nmol

SLC39A12 siRNA (Human)

Sign In for Pricing
View Details
ATIC (Bifunctional Purine Biosynthesis Protein PURH, Phosphoribosylaminoimidazolecarboxamide Formyltransferase, 5-aminoimidazole-4-carboxamide Ribonucleotide Formyltransferase, AICAR Transformylase, IMP Cyclohydrolase, ATIC, IMP Synthase, Inosinicase, PUR
MBS6370639-01 0.1 mL

ATIC (Bifunctional Purine Biosynthesis Protein PURH, Phosphoribosylaminoimidazolecarboxamide Formyltransferase, 5-aminoimidazole-4-carboxamide Ribonucleotide Formyltransferase, AICAR Transformylase, IMP Cyclohydrolase, ATIC, IMP Synthase, Inosinicase, PUR

Sign In for Pricing
View Details
ATIC (Bifunctional Purine Biosynthesis Protein PURH, Phosphoribosylaminoimidazolecarboxamide Formyltransferase, 5-aminoimidazole-4-carboxamide Ribonucleotide Formyltransferase, AICAR Transformylase, IMP Cyclohydrolase, ATIC, IMP Synthase, Inosinicase, PUR
MBS6370639-02 5x 0.1 mL

ATIC (Bifunctional Purine Biosynthesis Protein PURH, Phosphoribosylaminoimidazolecarboxamide Formyltransferase, 5-aminoimidazole-4-carboxamide Ribonucleotide Formyltransferase, AICAR Transformylase, IMP Cyclohydrolase, ATIC, IMP Synthase, Inosinicase, PUR

Sign In for Pricing
View Details
Anti-DNA Antibody (MRL-10)
ARO-A14403-01 50 µg

Anti-DNA Antibody (MRL-10)

Sign In for Pricing
View Details
Anti-DNA Antibody (MRL-10)
ARO-A14403-02 100 µg

Anti-DNA Antibody (MRL-10)

Sign In for Pricing
View Details