Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX4 Rabbit Polyclonal Antibody (HRP)

RFX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NYD-SP10

UniProt

Q33E94

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RFX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_998759

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD369/CLEC7A Antibody (15E2#), PE
HV829127-01 1 Each

Anti-Human CD369/CLEC7A Antibody (15E2#), PE

Sign In for Pricing
View Details
Anti-Human CD369/CLEC7A Antibody (15E2#), PE
HV829127-02 100 Tests

Anti-Human CD369/CLEC7A Antibody (15E2#), PE

Sign In for Pricing
View Details
LGALS9, Recombinant, Mouse, aa1-322, His-Tag (Galectin-9, Gal-9, Galectin-9, LGALS35, Lgals5)
351349-01 50 µg

LGALS9, Recombinant, Mouse, aa1-322, His-Tag (Galectin-9, Gal-9, Galectin-9, LGALS35, Lgals5)

Sign In for Pricing
View Details
LGALS9, Recombinant, Mouse, aa1-322, His-Tag (Galectin-9, Gal-9, Galectin-9, LGALS35, Lgals5)
351349-02 250 µg

LGALS9, Recombinant, Mouse, aa1-322, His-Tag (Galectin-9, Gal-9, Galectin-9, LGALS35, Lgals5)

Sign In for Pricing
View Details
CD55/DAF, Recombinant, Human, Fc-Tag, Active discontinued
047088 100 µg

CD55/DAF, Recombinant, Human, Fc-Tag, Active discontinued

Sign In for Pricing
View Details
Rabbit anti-human urocortin polyclonal Antibody
MBS713143-01 0.1 mL

Rabbit anti-human urocortin polyclonal Antibody

Sign In for Pricing
View Details