Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL5 Rabbit Polyclonal Antibody (FITC)

KLHL5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6Y881

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEV

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_950240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase 1 (lgt1)
MBS7018838-01 0.02 mg

Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase 1 (lgt1)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase 1 (lgt1)
MBS7018838-02 0.1 mg

Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase 1 (lgt1)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase 1 (lgt1)
MBS7018838-03 5x 0.1 mg

Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase 1 (lgt1)

Sign In for Pricing
View Details
PRC1 Rabbit mAb
C06210-01 20 µL

PRC1 Rabbit mAb

Sign In for Pricing
View Details
PRC1 Rabbit mAb
C06210-02 100 µL

PRC1 Rabbit mAb

Sign In for Pricing
View Details
PRC1 Rabbit mAb
C06210-03 2x 100 μL

PRC1 Rabbit mAb

Sign In for Pricing
View Details