Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRD9 Rabbit Polyclonal Antibody (HRP)

BRD9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRO9856, LAVS3040

UniProt

Q9H8M2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BRD9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001009877

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA (H15N8) (A/Duck/Aus/341/1983) Antigen ELISA Development Kit
IT-E3Ag-H15N8-Duck/Aus/341/1983 1 Kit

HA (H15N8) (A/Duck/Aus/341/1983) Antigen ELISA Development Kit

Sign In for Pricing
View Details
Donkey anti-Goat IgG Heavy and Light Chain Cross-Adsorbed Antibody Cy3®Conjugated
A50-201C3 0.5 mg

Donkey anti-Goat IgG Heavy and Light Chain Cross-Adsorbed Antibody Cy3®Conjugated

Sign In for Pricing
View Details
AF647 Anti-Mouse CD28 Antibody
MBS4516134-01 0.025 mg

AF647 Anti-Mouse CD28 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD28 Antibody
MBS4516134-02 0.05 mg

AF647 Anti-Mouse CD28 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD28 Antibody
MBS4516134-03 0.1 mg

AF647 Anti-Mouse CD28 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD28 Antibody
MBS4516134-04 0.2 mg

AF647 Anti-Mouse CD28 Antibody

Sign In for Pricing
View Details