Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF627 Rabbit Polyclonal Antibody (FITC)

ZNF627 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q7L945

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF627

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_660338

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TRAF1 Protein, His/GST-tagged
TRAF1-389H 10 µg

Recombinant Human TRAF1 Protein, His/GST-tagged

Sign In for Pricing
View Details
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial
orb1650239-01 20 µg

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Sign In for Pricing
View Details
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial
orb1650239-02 100 µg

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Sign In for Pricing
View Details
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial
orb1650239-03 1 mg

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Sign In for Pricing
View Details
Recombinant Human PLA2G2D/ Phospholipase A2 IID Protein, His-SUMO, E.coli-100ug
QP8240-ec-100ug 100ug

Recombinant Human PLA2G2D/ Phospholipase A2 IID Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae TUB4 Protein (aa 1-473) [His]
VAng-Wyb6091-1mg 1 mg

Recombinant Saccharomyces Cerevisiae TUB4 Protein (aa 1-473) [His]

Sign In for Pricing
View Details