Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF22 Rabbit Polyclonal Antibody (Biotin)

ZNF22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KOX15, HKR-T1, ZNF422, Zfp422

UniProt

P17026

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSW

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_008894

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome b-c1 complex subunit 10 (UQCR) Human ELISA Kit
C7453 96 Tests

Cytochrome b-c1 complex subunit 10 (UQCR) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1373485-01 0.02 mg (E-Coli)

Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1373485-02 0.02 mg (Yeast)

Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1373485-03 0.1 mg (E-Coli)

Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1373485-04 0.1 mg (Yeast)

Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1373485-05 0.02 mg (Baculovirus)

Recombinant Porphyra yezoensis DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details