Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL25 Rabbit Polyclonal Antibody (Biotin)

KLHL25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ENC2, ENC-2

UniProt

Q9H0H3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL25

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_071925

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB1 (Leukocyte Elastase Inhibitor, LEI, Monocyte/Neutrophil Elastase Inhibitor, EI, M/NEI, Peptidase Inhibitor 2, PI-2, Serpin B1, ELANH2, MNEI, PI2) (MaxLight 405)
MBS6192551-01 0.1 mL

SERPINB1 (Leukocyte Elastase Inhibitor, LEI, Monocyte/Neutrophil Elastase Inhibitor, EI, M/NEI, Peptidase Inhibitor 2, PI-2, Serpin B1, ELANH2, MNEI, PI2) (MaxLight 405)

Sign In for Pricing
View Details
SERPINB1 (Leukocyte Elastase Inhibitor, LEI, Monocyte/Neutrophil Elastase Inhibitor, EI, M/NEI, Peptidase Inhibitor 2, PI-2, Serpin B1, ELANH2, MNEI, PI2) (MaxLight 405)
MBS6192551-02 5x 0.1 mL

SERPINB1 (Leukocyte Elastase Inhibitor, LEI, Monocyte/Neutrophil Elastase Inhibitor, EI, M/NEI, Peptidase Inhibitor 2, PI-2, Serpin B1, ELANH2, MNEI, PI2) (MaxLight 405)

Sign In for Pricing
View Details
Anti-INA Polyclonal Antibody
HA820014-01 50 µg

Anti-INA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-INA Polyclonal Antibody
HA820014-02 100 µg

Anti-INA Polyclonal Antibody

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Arrhythmia, Infarct, Heart, Left Atrium (Frozen) HisTekTM
T5595-5112B4 5 Slides

Tissue, Section, Human Disease, Arrhythmia, Infarct, Heart, Left Atrium (Frozen) HisTekTM

Sign In for Pricing
View Details
Recombinant Naegleria fowleri Unknown protein NF016 from 2D-PAGE
MBS1082816-01 0.05 mg (E-Coli)

Recombinant Naegleria fowleri Unknown protein NF016 from 2D-PAGE

Sign In for Pricing
View Details