Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSF2BP Rabbit Polyclonal Antibody (Biotin)

HSF2BP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

POF19, MEILB2

UniProt

O75031

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSF2BP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_008962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Human CD1a Flow Cytometry Monoclonal Clone OKT6 AF488 Ready To Use 100 Tests
IMSAHUCD1AOKT6CAF488100 100 Tests

Anti Human CD1a Flow Cytometry Monoclonal Clone OKT6 AF488 Ready To Use 100 Tests

Sign In for Pricing
View Details
KappaB ras Antibody
orb74456 100 µL

KappaB ras Antibody

Sign In for Pricing
View Details
SCN5A, NT (SCN5A, Sodium channel protein type 5 subunit alpha, HH1, Sodium channel protein cardiac muscle subunit alpha, Sodium channel protein type V subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.5) (Azide free) (HRP) discontinued
041466-HRP 200 µL

SCN5A, NT (SCN5A, Sodium channel protein type 5 subunit alpha, HH1, Sodium channel protein cardiac muscle subunit alpha, Sodium channel protein type V subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.5) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
NRG4 Antibody Blocking peptide
orb1448234 500 µg

NRG4 Antibody Blocking peptide

Sign In for Pricing
View Details
Lentiviral mouse Taf9 shRNA (UAS) - Lentiviral mouse Taf9 shRNA (UAS, RFP) (100)
GTR15180204 1 Vial

Lentiviral mouse Taf9 shRNA (UAS) - Lentiviral mouse Taf9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SLC25A21 Antibody
orb671319-01 50 µg

SLC25A21 Antibody

Sign In for Pricing
View Details