Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF614 Rabbit Polyclonal Antibody (HRP)

ZNF614 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8N883

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF614

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_079316

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYP27A1 (Cytochrome P450 27A1) ELISA Kit
ELK4688-01 48 Tests

Human CYP27A1 (Cytochrome P450 27A1) ELISA Kit

Sign In for Pricing
View Details
Human CYP27A1 (Cytochrome P450 27A1) ELISA Kit
ELK4688-02 96 Tests

Human CYP27A1 (Cytochrome P450 27A1) ELISA Kit

Sign In for Pricing
View Details
Human CYP27A1 (Cytochrome P450 27A1) ELISA Kit
ELK4688-03 5x 96 Tests

Human CYP27A1 (Cytochrome P450 27A1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Ostreid herpesvirus 1 Ribonucleoside-diphosphate reductase small chain (ORF20), partial
MBS1422970 Inquire

Recombinant Ostreid herpesvirus 1 Ribonucleoside-diphosphate reductase small chain (ORF20), partial

Sign In for Pricing
View Details
Lentiviral human WNT1 sgRNA gene knockout kit - Lentiviral human WNT1 sgRNA gene knockout kit (100)
GTR15369526 1 Vial

Lentiviral human WNT1 sgRNA gene knockout kit - Lentiviral human WNT1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Mouse Frizzled-6 (Fzd6)
MBS7015415-01 0.02 mg

Recombinant Mouse Frizzled-6 (Fzd6)

Sign In for Pricing
View Details