Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF614 Rabbit Polyclonal Antibody (Biotin)

ZNF614 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N883

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZN614

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFTKHLKTNTTDKICIPNEYRKGSTVKSSLITHQQTHTEEKSYMCSECGK

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_079316

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIP1L1 (Rearranged in Hypereosinophilia, FIP1-like 1 Protein, Factor Interacting with PAP, Pre-mRNA 3'-end-processing Factor FIP1, hFip1, FIP1, RHE, DKFZp586K0717, FLJ33619) (FITC)
MBS6147216-01 0.1 mL

FIP1L1 (Rearranged in Hypereosinophilia, FIP1-like 1 Protein, Factor Interacting with PAP, Pre-mRNA 3'-end-processing Factor FIP1, hFip1, FIP1, RHE, DKFZp586K0717, FLJ33619) (FITC)

Sign In for Pricing
View Details
FIP1L1 (Rearranged in Hypereosinophilia, FIP1-like 1 Protein, Factor Interacting with PAP, Pre-mRNA 3'-end-processing Factor FIP1, hFip1, FIP1, RHE, DKFZp586K0717, FLJ33619) (FITC)
MBS6147216-02 5x 0.1 mL

FIP1L1 (Rearranged in Hypereosinophilia, FIP1-like 1 Protein, Factor Interacting with PAP, Pre-mRNA 3'-end-processing Factor FIP1, hFip1, FIP1, RHE, DKFZp586K0717, FLJ33619) (FITC)

Sign In for Pricing
View Details
LIME1 Antibody, HRP conjugated
A70174-50UG 50 µg

LIME1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Phospho-TPH2 (Ser19) Polyclonal Antibody, Biotin Conjugated
bs-17166R-Biotin 100 µL

Phospho-TPH2 (Ser19) Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TNFRSF13C ELISA Kit (Rat) (OKEI00691)
OKEI00691 96 Well

TNFRSF13C ELISA Kit (Rat) (OKEI00691)

Sign In for Pricing
View Details
Rat ICAM-1/CD54 Antibody Pair Set
MBS2577798-01 1 Pair

Rat ICAM-1/CD54 Antibody Pair Set

Sign In for Pricing
View Details