Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM40 Rabbit Polyclonal Antibody (HRP)

TRIM40 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF35

UniProt

Q6P9F5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRI40

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DR (6A96)
sc-71260 200 µg/mL

HLA-DR (6A96)

Sign In for Pricing
View Details
Sgk3, CT (Sgk3, Cisk, Sgkl, Serine/threonine-protein kinase Sgk3, Cytokine-independent survival kinase, Serum/glucocorticoid-regulated kinase 3, Serum/glucocorticoid-regulated kinase-like) (MaxLight 650) discontinued
041663-ML650 100 µL

Sgk3, CT (Sgk3, Cisk, Sgkl, Serine/threonine-protein kinase Sgk3, Cytokine-independent survival kinase, Serum/glucocorticoid-regulated kinase 3, Serum/glucocorticoid-regulated kinase-like) (MaxLight 650) discontinued

Sign In for Pricing
View Details
NECAP2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb959165 100 µL

NECAP2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Human B4GALT1 qPCR Primer Pair
QH14897S 200 Tests

Human B4GALT1 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Transmembrane protein 60 (TMEM60) ELISA Kit
EK6374 48 Tests

Mouse Transmembrane protein 60 (TMEM60) ELISA Kit

Sign In for Pricing
View Details
FTO Knockout A549 Polyclonal Cells
ARG10506 1 Million

FTO Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details