Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF568 Rabbit Polyclonal Antibody (HRP)

ZNF568 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP568

UniProt

Q6N060

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF568

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VWEVDEQVKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVT

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_940941

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX21 (T-Box Protein 21, TBLYM, TBET, T-box transcription factor TBX21, T-cell-specific T-box transcription factor T-bet)
365239 200 µL

TBX21 (T-Box Protein 21, TBLYM, TBET, T-box transcription factor TBX21, T-cell-specific T-box transcription factor T-bet)

Sign In for Pricing
View Details
Semaphorin 4D Antibody, mAb, Rabbit
A05485-100 100 µL

Semaphorin 4D Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Olfactory receptor 10AG1 Polyclonal Antibody
ABP52008-01 30 µL

Olfactory receptor 10AG1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 10AG1 Polyclonal Antibody
ABP52008-02 100 µL

Olfactory receptor 10AG1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 10AG1 Polyclonal Antibody
ABP52008-03 200 µL

Olfactory receptor 10AG1 Polyclonal Antibody

Sign In for Pricing
View Details
Hoxa11-set siRNA/shRNA/RNAi Lentivector (Mouse)
23801094 4x 500 ng

Hoxa11-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details