Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED23 Rabbit Polyclonal Antibody (HRP)

MED23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SUR2, CRSP3, MRT18, SUR-2, ARC130, CRSP130, CRSP133, DRIP130

UniProt

Q9ULK4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MED23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

156kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004821

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Siglec 7 (SIGLEC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A1]
TA507377AM 100 µL

Siglec 7 (SIGLEC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details
ACTR3C (NM_001164458) Human Over-expression Lysate
LC431172 20 µg

ACTR3C (NM_001164458) Human Over-expression Lysate

Sign In for Pricing
View Details
Taf9 (BC019453) Mouse Tagged ORF Clone
MG201449 10 µg

Taf9 (BC019453) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS808675 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
PYCR3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E10]
TA502035AM 100 µL

PYCR3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E10]

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560928 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details