Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED23 Rabbit Polyclonal Antibody (Biotin)

MED23 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SUR2, CRSP3, MRT18, SUR-2, ARC130, CRSP130, CRSP133, DRIP130

UniProt

Q9ULK4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MED23

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

156kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004821

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CADM2 Protein, His (Fc)-Avi-tagged
CADM2-1183M 50 µg

Recombinant Mouse CADM2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
WBSCR22, CT (WBSCR22, Uncharacterized methyltransferase WBSCR22, Williams-Beuren syndrome chromosomal region 22 protein) (APC) discontinued
043811-APC 200 µL

WBSCR22, CT (WBSCR22, Uncharacterized methyltransferase WBSCR22, Williams-Beuren syndrome chromosomal region 22 protein) (APC) discontinued

Sign In for Pricing
View Details
CAPRIN1 Antibody
orb1248095 0.1 mg

CAPRIN1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SMCHD1 Antibody
NBP1-82978-25ul 25 µL

Rabbit Polyclonal SMCHD1 Antibody

Sign In for Pricing
View Details
Olr1629 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV634786 1.0 µg DNA

Olr1629 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
DTNA CRISPRa sgRNA lentivector (set of three targets)(Mouse)
18643124 3x 1.0µg DNA

DTNA CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details