Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIDO1 Rabbit Polyclonal Antibody (FITC)

DIDO1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BYE1, DIO1, DATF1, DIDO2, DIDO3, DIO-1, DATF-1, C20orf158, dJ885L7.8

UniProt

Q9BTC0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DIDO1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDDKGDPSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAEADPLEP

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL1 autoantibody) Human ELISA Kit
B5593 96 Tests

Anti-IL1 autoantibody) Human ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-449c-3p miRNA Mimic
CMH0890-01 5 nmol

Hsa-miR-449c-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-449c-3p miRNA Mimic
CMH0890-02 10 nmol

Hsa-miR-449c-3p miRNA Mimic

Sign In for Pricing
View Details
Human SUGT1 Pre-designed siRNA Set A
SI016027A 1 Each

Human SUGT1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SPO11, CT (SPO11, Meiotic recombination protein SPO11, Cancer/testis antigen 35) (APC)
MBS6350707-01 0.2 mL

SPO11, CT (SPO11, Meiotic recombination protein SPO11, Cancer/testis antigen 35) (APC)

Sign In for Pricing
View Details
SPO11, CT (SPO11, Meiotic recombination protein SPO11, Cancer/testis antigen 35) (APC)
MBS6350707-02 5x 0.2 mL

SPO11, CT (SPO11, Meiotic recombination protein SPO11, Cancer/testis antigen 35) (APC)

Sign In for Pricing
View Details