Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIDO1 Rabbit Polyclonal Antibody (HRP)

DIDO1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BYE1, DIO1, DATF1, DIDO2, DIDO3, DIO-1, DATF-1, C20orf158, dJ885L7.8

UniProt

Q9BTC0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DIDO1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETASEGSVESASET

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_542987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SensiStain™ Anti-SAA1 Antibody
HY000284 0.1 mL

SensiStain™ Anti-SAA1 Antibody

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF647 conjugate, 0.1mg/mL
BNC470912-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NTR/912), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565667 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
Human DUOXA1 activation kit by CRISPRa
GA114032 1 Kit

Human DUOXA1 activation kit by CRISPRa

Sign In for Pricing
View Details
C9ORF46 (PLGRKT) Human Gene Knockout Kit (CRISPR)
KN402315 1 Kit

C9ORF46 (PLGRKT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD99 / MIC2 (Ewing's Sarcoma Marker), CF488A conjugate, 0.1mg/mL
BNC881646-100 1x 100 µL

CD99 / MIC2 (Ewing's Sarcoma Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details