Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM41 Rabbit Polyclonal Antibody (Biotin)

TRIM41 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RINCK

UniProt

B3KNJ6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM41

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQPSLTYYVCPTDRPEFSF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_963921

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme B (GRB, GZMB, C11, Cathespin G-like 1, CCPI, CGL1, CGL-1, CSPB, CSP-B, CTLA1, CTLA-1, Cytotoxic T Lymphocyte-associated Serine Esterase 1, CTSGL1, Cytotoxic T Lymphocyte Proteinase 2, Fragmentin 2, Fragmentin-2, Granzyme 2, Human Lymphocyte Protein, HLP, Lymphocyte Protease, Protease Serine B, SECT, T-cell Serine Protease 1-3E)
G8957-01H 250 µL

Granzyme B (GRB, GZMB, C11, Cathespin G-like 1, CCPI, CGL1, CGL-1, CSPB, CSP-B, CTLA1, CTLA-1, Cytotoxic T Lymphocyte-associated Serine Esterase 1, CTSGL1, Cytotoxic T Lymphocyte Proteinase 2, Fragmentin 2, Fragmentin-2, Granzyme 2, Human Lymphocyte Protein, HLP, Lymphocyte Protease, Protease Serine B, SECT, T-cell Serine Protease 1-3E)

Sign In for Pricing
View Details
Dog ALD (Aldosterone) ELISA Kit
MBS8807990-01 48 Well

Dog ALD (Aldosterone) ELISA Kit

Sign In for Pricing
View Details
Dog ALD (Aldosterone) ELISA Kit
MBS8807990-02 96 Well

Dog ALD (Aldosterone) ELISA Kit

Sign In for Pricing
View Details
Dog ALD (Aldosterone) ELISA Kit
MBS8807990-03 5x 96 Well

Dog ALD (Aldosterone) ELISA Kit

Sign In for Pricing
View Details
Dog ALD (Aldosterone) ELISA Kit
MBS8807990-04 10x 96 Well

Dog ALD (Aldosterone) ELISA Kit

Sign In for Pricing
View Details
TXNL1, CT (Thioredoxin-like Protein 1, 32kD Thioredoxin-related Protein, TXNL1, TRP32, TXL, TXNL, TrxL) (MaxLight 650) discontinued
T5011-51B-ML650 100 µL

TXNL1, CT (Thioredoxin-like Protein 1, 32kD Thioredoxin-related Protein, TXNL1, TRP32, TXL, TXNL, TrxL) (MaxLight 650) discontinued

Sign In for Pricing
View Details