Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF682 Rabbit Polyclonal Antibody (Biotin)

ZNF682 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BC39498_3

UniProt

O95780

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF682

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NRENIRHTTEKLFKCMQCGKVFKSHSGLSYHKIIHTEEKLCICEECGKTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_149973.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPCA00368-20UG - Recombinant human Chromodomain-helicase-DNA-binding protein 4
OPCA00368-20UG 20 µg

OPCA00368-20UG - Recombinant human Chromodomain-helicase-DNA-binding protein 4

Sign In for Pricing
View Details
OTSC7 sgRNA CRISPR Lentivector (Human) (Target 3)
K1577804 1.0 µg DNA

OTSC7 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit
MBS9321491-01 48 Well

Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit

Sign In for Pricing
View Details
Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit
MBS9321491-02 96 Well

Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit

Sign In for Pricing
View Details
Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit
MBS9321491-03 5x 96 Well

Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit

Sign In for Pricing
View Details
Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit
MBS9321491-04 10x 96 Well

Mouse Eukaryotic translation elongation factor 1 epsilon-1, EEF1E1 ELISA Kit

Sign In for Pricing
View Details