Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn1 Rabbit Polyclonal Antibody (HRP)

Clcn1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SMCC

UniProt

P35524

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vascular Endothelial cell Growth Factor B, VEGF-B ELISA kit
YLA0983MO-01 48 Tests

Mouse Vascular Endothelial cell Growth Factor B, VEGF-B ELISA kit

Sign In for Pricing
View Details
Mouse Vascular Endothelial cell Growth Factor B, VEGF-B ELISA kit
YLA0983MO-02 96 Tests

Mouse Vascular Endothelial cell Growth Factor B, VEGF-B ELISA kit

Sign In for Pricing
View Details
Recombinant Human TECPR1 Protein
E30P65165A 50 µg

Recombinant Human TECPR1 Protein

Sign In for Pricing
View Details
FAM177A1 (NM_173607) Human Tagged Lenti ORF Clone
RC216009L2 10 µg

FAM177A1 (NM_173607) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Ku70/XRCC6 Antibody Picoband® Fluoro488 Conjugated
PB9520-Fluoro488 100 µg/Vial

Anti-Ku70/XRCC6 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
LYSMD4 Protein Lysate (Mouse) with C-HA Tag
27856034 100 µg

LYSMD4 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details