Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn1 Rabbit Polyclonal Antibody (HRP)

Clcn1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SMCC

UniProt

P35524

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cosan-528 100mg
A22661-100 100 mg

Cosan-528 100mg

Sign In for Pricing
View Details
CSNK2A1 (Casein Kinase II alpha, Casein Kinase II Subunit alpha, Ck2 alpha, CK2 catalytic Subunit alpha, CKII, CKIIalpha, CK2A1, CKII alpha, Protein Kinase CK2, Casein Kinase 2 alpha, CK II alpha) discontinued
170345 50 µL

CSNK2A1 (Casein Kinase II alpha, Casein Kinase II Subunit alpha, Ck2 alpha, CK2 catalytic Subunit alpha, CKII, CKIIalpha, CK2A1, CKII alpha, Protein Kinase CK2, Casein Kinase 2 alpha, CK II alpha) discontinued

Sign In for Pricing
View Details
Collagen coated cover glasses
1427568 90PK

Collagen coated cover glasses

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus 33 kDa chaperonin (hslO)
MBS1118072-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus 33 kDa chaperonin (hslO)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus 33 kDa chaperonin (hslO)
MBS1118072-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus 33 kDa chaperonin (hslO)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus 33 kDa chaperonin (hslO)
MBS1118072-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus 33 kDa chaperonin (hslO)

Sign In for Pricing
View Details