Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn5 Rabbit Polyclonal Antibody (Biotin)

Clcn5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Clc, ClC-, Clc5, Sfc1, ClC-5, Clc4-, Clcn4, Sfc13, Clc4-1, T25545, Clcn4-1, DXImx42, DXImx42e, 5430408K11Rik, D930009B12Rik

UniProt

Q9WVD4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057900

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Actin Rabbit mAb
F0012-100uL*2 2x 100 μL

β-Actin Rabbit mAb

Sign In for Pricing
View Details
DTYMK sgRNA CRISPR Lentivector (Human) (Target 3)
K0636604 1.0 µg DNA

DTYMK sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Mouse BMP-8a CF
7540-BP-025 25 µg

Recombinant Mouse BMP-8a CF

Sign In for Pricing
View Details
Gsn (NM_001004080) Rat Tagged Lenti ORF Clone
RR201675L3 10 µg

Gsn (NM_001004080) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4) ELISA Kit
MBS4503122-01 48 Tests

Rat Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4) ELISA Kit

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4) ELISA Kit
MBS4503122-02 96 Tests

Rat Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4) ELISA Kit

Sign In for Pricing
View Details