Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA1 Rabbit Polyclonal Antibody (FITC)

KCNA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EA1, MK1, AEMK, HBK1, HUK1, MBK1, RBK1, KV1.1

UniProt

Q09470

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_000208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110A-01 25 µg

Purified Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Purified Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110A-02 100 µg

Purified Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
MTF1 (MTF1/2649), CF568 conjugate, 0.1mg/mL
BNC682649-100 1x 100 µL

MTF1 (MTF1/2649), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF647 conjugate, 0.1mg/mL
BNC472408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Miz1 (ZBTB17) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
CF811357 100 µg

Miz1 (ZBTB17) Mouse Monoclonal Antibody [Clone ID: OTI2G1]

Sign In for Pricing
View Details
Rat Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit
RDR-TAFI-Ra-01 96 Tests

Rat Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit

Sign In for Pricing
View Details