Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh2 Rabbit Polyclonal Antibody (FITC)

Kcnh2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LQ, ERG, LQT, ERG1, Lqt2, M-er, M-erg, Merg1, merg1a, merg1b, AI326795

UniProt

O35219

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

127kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Myelin and lymphocyte protein ELISA Kit
MBS288754-01 48 Well

Mouse Myelin and lymphocyte protein ELISA Kit

Sign In for Pricing
View Details
Mouse Myelin and lymphocyte protein ELISA Kit
MBS288754-02 96 Well

Mouse Myelin and lymphocyte protein ELISA Kit

Sign In for Pricing
View Details
Mouse Myelin and lymphocyte protein ELISA Kit
MBS288754-03 5x 96 Well

Mouse Myelin and lymphocyte protein ELISA Kit

Sign In for Pricing
View Details
Mouse Myelin and lymphocyte protein ELISA Kit
MBS288754-04 10x 96 Well

Mouse Myelin and lymphocyte protein ELISA Kit

Sign In for Pricing
View Details
Recombinant Human DSG2 Protein
E30P00524B 50 µg

Recombinant Human DSG2 Protein

Sign In for Pricing
View Details
rno-miR-760-3p miRNA Mimic
MBS8302872-01 5 nmol

rno-miR-760-3p miRNA Mimic

Sign In for Pricing
View Details