Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh2 Rabbit Polyclonal Antibody (HRP)

Kcnh2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LQ, ERG, LQT, ERG1, Lqt2, M-er, M-erg, Merg1, merg1a, merg1b, AI326795

UniProt

O35219

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

127kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CADM2 Antibody
8C12109-AAT 50 µg

CADM2 Antibody

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Human Gene Knockout Kit (CRISPR)
KN208947RB 1 Kit

beta Catenin (CTNNB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF568 conjugate, 0.1mg/mL
BNC682007-100 1x 100 µL

MHC II, Mouse (MK-D6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NAPSIN A (NAPSA) (N-term) Mouse Monoclonal Antibody [Clone ID: KCG1.1]
AM03172PU-N 1 mL

NAPSIN A (NAPSA) (N-term) Mouse Monoclonal Antibody [Clone ID: KCG1.1]

Sign In for Pricing
View Details
PIGX (N-term) Rabbit Polyclonal Antibody
AP53302PU-N 400 µL

PIGX (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bufotenine-d4 Hydrochloride
TRC-B689467-25MG 25 mg

Bufotenine-d4 Hydrochloride

Sign In for Pricing
View Details