Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh2 Rabbit Polyclonal Antibody (Biotin)

Kcnh2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LQ, ERG, LQT, ERG1, Lqt2, M-er, M-erg, Merg1, merg1a, merg1b, AI326795

UniProt

O35219

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

127kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 Recombinant Rabbit mAb, BF680 conjugated
orb3163264 100 µL

HSP60 Recombinant Rabbit mAb, BF680 conjugated

Sign In for Pricing
View Details
Destain Solution Conc. 20X - 250 Ml
CSL-DS20X250 250 m L

Destain Solution Conc. 20X - 250 Ml

Sign In for Pricing
View Details
C Peptide (mouse) Rabbit pAb, PE-Cy5 conjugated
orb2819548 100 µL

C Peptide (mouse) Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Lentiviral mouse Tgs1 shRNA (UAS) - Lentiviral mouse Tgs1 shRNA (UAS, GFP) plasmid
GTR15299677 1 Vial

Lentiviral mouse Tgs1 shRNA (UAS) - Lentiviral mouse Tgs1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ZNF821 (NM_017530) Human Over-expression Lysate
LS055565-100ug 100 µg

ZNF821 (NM_017530) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Cdkn2c/Cyclin-dependent kinase 4 inhibitor C ELISA Kit
orb1661539 96 Tests

Mouse Cdkn2c/Cyclin-dependent kinase 4 inhibitor C ELISA Kit

Sign In for Pricing
View Details