Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKD2 Rabbit Polyclonal Antibody (HRP)

PKD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PC2, PKD4, Pc-2, APKD2, TRPP2

UniProt

Q13563

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PKD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nup35 shRNA (UAS) - Lentiviral mouseNup35 shRNA (UAS, GFP) (25)
GTR15229136 1 Vial

Lentiviral mouse Nup35 shRNA (UAS) - Lentiviral mouseNup35 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
HAX1 Rabbit Polyclonal Antibody (PerCP)
orb2391712 100 µL

HAX1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Lentiviral mouse Ska1 shRNA (UAS) - Lentiviral mouse Ska1 shRNA (UAS, GFP) plasmid
GTR15239782 1 Vial

Lentiviral mouse Ska1 shRNA (UAS) - Lentiviral mouse Ska1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Mrgpra2b shRNA (UAS) - Lentiviral mouse Mrgpra2b shRNA (UAS) (100)
GTR15209322 1 Vial

Lentiviral mouse Mrgpra2b shRNA (UAS) - Lentiviral mouse Mrgpra2b shRNA (UAS) (100)

Sign In for Pricing
View Details
S100A14 Antibody
orb681035 100 µL

S100A14 Antibody

Sign In for Pricing
View Details
Hamster Histone Deacetylase 1 ELISA Kit
MBS068142-01 48 Well

Hamster Histone Deacetylase 1 ELISA Kit

Sign In for Pricing
View Details