Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKD2 Rabbit Polyclonal Antibody (Biotin)

PKD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PC2, PKD4, Pc-2, APKD2, TRPP2

UniProt

Q13563

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PKD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E. coli (O+K antigens) Rabbit Polyclonal Antibody
BP1021B 1 mL

E. coli (O+K antigens) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD168/HMMR Antibody Picoband®, Carrier-free
PA1592-carrier-free 100 µg/Vial

Anti-CD168/HMMR Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
ELISA kit for Bovine Mitochondrial import receptor subunit TOM40B (TOMM40L)
KTE10008-01 48 Tests

ELISA kit for Bovine Mitochondrial import receptor subunit TOM40B (TOMM40L)

Sign In for Pricing
View Details
ELISA kit for Bovine Mitochondrial import receptor subunit TOM40B (TOMM40L)
KTE10008-02 96 Tests

ELISA kit for Bovine Mitochondrial import receptor subunit TOM40B (TOMM40L)

Sign In for Pricing
View Details
ELISA kit for Bovine Mitochondrial import receptor subunit TOM40B (TOMM40L)
KTE10008-03 5x 96 Well

ELISA kit for Bovine Mitochondrial import receptor subunit TOM40B (TOMM40L)

Sign In for Pricing
View Details
C16orf48 Rabbit Polyclonal Antibody (HRP)
orb2110733 100 µL

C16orf48 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details