Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIA2 Rabbit Polyclonal Antibody (HRP)

GRIA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2

UniProt

P42262

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human GRIA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTT

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000817.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Choline Transporter-Like protein 5 (SLC44A5) Human ELISA Kit
C3464 96 Tests

Choline Transporter-Like protein 5 (SLC44A5) Human ELISA Kit

Sign In for Pricing
View Details
TROVE2 Antibody
A45411-100UG 100 µg

TROVE2 Antibody

Sign In for Pricing
View Details
LncRNA Profiler Complete qPCR Array Kit (cDNA synthesis kit, qPCR array and SYBR Green reagent)  20 profiles
RA910A-1 20 Profiles

LncRNA Profiler Complete qPCR Array Kit (cDNA synthesis kit, qPCR array and SYBR Green reagent) 20 profiles

Sign In for Pricing
View Details
Human SLC6A4/5-HTTLPR MAb (Clone 632705)
MAB17292-SP 25 µg

Human SLC6A4/5-HTTLPR MAb (Clone 632705)

Sign In for Pricing
View Details
CXorf22, ID (Uncharacterized Protein CXorf22, CXorf22)
C8375-80 200 µL

CXorf22, ID (Uncharacterized Protein CXorf22, CXorf22)

Sign In for Pricing
View Details
CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta (3-72), SDF-1-alpha (3-67) ) (PE) discontinued
034381-PE 200 µL

CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta (3-72), SDF-1-alpha (3-67) ) (PE) discontinued

Sign In for Pricing
View Details