Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIN2B Rabbit Polyclonal Antibody (FITC)

GRIN2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NR3, MRD6, NR2B, hNR3, DEE27, EIEE27, GluN2B, NMDAR2B

UniProt

Q13224

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GRIN2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

163kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000825

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TIM-3 Antibody (TIM3/3113) [Alexa Fluor 647]
NBP2-79836AF647 0.1 mL

Mouse Monoclonal TIM-3 Antibody (TIM3/3113) [Alexa Fluor 647]

Sign In for Pricing
View Details
RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (Biotin)
251355-Biotin 100 µL

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (Biotin)

Sign In for Pricing
View Details
CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1) discontinued
359980-01 50 µL

CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1) discontinued

Sign In for Pricing
View Details
CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1) discontinued
359980-02 100 µL

CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1) discontinued

Sign In for Pricing
View Details
FGF18 Rabbit pAb, Pacific Blue conjugated
orb2839654 100 µL

FGF18 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Recombinant Escherichia coli Probable lipid kinase YegS (yegS)
MBS1203061-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Probable lipid kinase YegS (yegS)

Sign In for Pricing
View Details