Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Accn2 Rabbit Polyclonal Antibody (HRP)

Accn2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, AS, Acc, BNa, ASIC, Accn2, BNaC2, ASIC1a, AI843610, B530003N02Rik

UniProt

Q6NXK8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MELKTEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033727

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC049635 3'UTR GFP Stable Cell Line
TU152620 1.0 mL

BC049635 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HIST1H3A (Ab-56) Antibody
A77698-100UL 100 µL

HIST1H3A (Ab-56) Antibody

Sign In for Pricing
View Details
Anti-SLC22A3/OCT3 Rabbit pAb
GB114658-50 50 μL

Anti-SLC22A3/OCT3 Rabbit pAb

Sign In for Pricing
View Details
PHACTR1 Peptide
DF15496-BP 1 mg

PHACTR1 Peptide

Sign In for Pricing
View Details
DYX5 sgRNA CRISPR Lentivector (Human) (Target 3)
K0647104 1.0 µg DNA

DYX5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HIST1H2BA, NT (HIST1H2BA, TSH2B, Histone H2B type 1-A, Histone H2B, testis, Testis-specific histone H2B) (MaxLight 405) discontinued
036592-ML405 100 µL

HIST1H2BA, NT (HIST1H2BA, TSH2B, Histone H2B type 1-A, Histone H2B, testis, Testis-specific histone H2B) (MaxLight 405) discontinued

Sign In for Pricing
View Details