Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC1 Rabbit Polyclonal Antibody (FITC)

CLIC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G6, CL1C1, NCC27, CLCNL1

UniProt

O00299

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti Keratin 14 ELISA Kit
MBS1610806 96 Well

Human anti Keratin 14 ELISA Kit

Sign In for Pricing
View Details
C6orf54 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0244508 1.0 µg DNA

C6orf54 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)
MBS1316799-01 0.02 mg (E-Coli)

Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)

Sign In for Pricing
View Details
Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)
MBS1316799-02 0.1 mg (E-Coli)

Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)

Sign In for Pricing
View Details
Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)
MBS1316799-03 0.02 mg (Yeast)

Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)

Sign In for Pricing
View Details
Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)
MBS1316799-04 0.1 mg (Yeast)

Recombinant Brucella abortus Urease accessory protein UreG 1 (ureG1)

Sign In for Pricing
View Details