Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC1 Rabbit Polyclonal Antibody (HRP)

CLIC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G6, CL1C1, NCC27, CLCNL1

UniProt

O00299

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gas Chromatography BCHR-108
BCHR-108 1 Unit

Gas Chromatography BCHR-108

Sign In for Pricing
View Details
(+)-b-Pinene
TRC-P466618-500MG 500 mg

(+)-b-Pinene

Sign In for Pricing
View Details
DYKDDDDK tag, AlpHcAbs® Mouse antibody
HA710084 100 µg

DYKDDDDK tag, AlpHcAbs® Mouse antibody

Sign In for Pricing
View Details
CD47 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]
TA813263AM 100 µL

CD47 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]

Sign In for Pricing
View Details
FAM76A (NM_001143912) Human Over-expression Lysate
LC428401 20 µg

FAM76A (NM_001143912) Human Over-expression Lysate

Sign In for Pricing
View Details
Bulk Anti-Human CD119 (GIR 208) Antibody
ICH1028-50mg 50 mg

Bulk Anti-Human CD119 (GIR 208) Antibody

Sign In for Pricing
View Details