Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glra3 Rabbit Polyclonal Antibody (HRP)

Glra3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q91XP5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIR

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_536686

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP58 Rabbit Polyclonal Antibody (Biotin)
orb2599000 100 µg

NUP58 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SIRP alpha (SIRPA) Mouse Monoclonal Antibody [Clone 1B5]
E45M14250V-2 50 µL

SIRP alpha (SIRPA) Mouse Monoclonal Antibody [Clone 1B5]

Sign In for Pricing
View Details
TOMM7 cDNA Clone
MBS1272450-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TOMM7 cDNA Clone

Sign In for Pricing
View Details
TOMM7 cDNA Clone
MBS1272450-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TOMM7 cDNA Clone

Sign In for Pricing
View Details
Porcine Phospho Epidermal Growth Factor Receptor ELISA Kit
MBS005373-01 48 Well

Porcine Phospho Epidermal Growth Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Porcine Phospho Epidermal Growth Factor Receptor ELISA Kit
MBS005373-02 96 Well

Porcine Phospho Epidermal Growth Factor Receptor ELISA Kit

Sign In for Pricing
View Details