Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grik5 Rabbit Polyclonal Antibody (HRP)

Grik5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KA, KA2, GluK5, GluRga, GluRgamma2

UniProt

Q80WU3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRD4 AAV Vector (Human) (CMV)
18597101 1 µg

DRD4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rat IgG1 Heavy Chain Secondary Antibody [Biotin]
NB7117B 1 mL

Goat Polyclonal Goat anti-Rat IgG1 Heavy Chain Secondary Antibody [Biotin]

Sign In for Pricing
View Details
GSK256066 5mg
A11073-5 5 mg

GSK256066 5mg

Sign In for Pricing
View Details
O-Cresolphthaleine Complexone (Phthalein Purple)
1032080 5 5 g

O-Cresolphthaleine Complexone (Phthalein Purple)

Sign In for Pricing
View Details
CITED2 Protein Lysate (Rat) with C-HA Tag
16207036 100 µg

CITED2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral human USP43 shRNA (UAS) - Lentiviral human USP43 shRNA (UAS, iRFP) (100)
GTR15149355 1 Vial

Lentiviral human USP43 shRNA (UAS) - Lentiviral human USP43 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details