Animal-Free IL-17F, Human (His)
IL-17F protein is a key effector cytokine in innate and adaptive immunity that maintains tissue integrity and protects against microorganisms. It acts through the IL17RA-IL17RC receptor complex, activates the NF-kappa-B and MAPkinase pathways, and induces the transcription of immune-related genes. Animal-Free IL-17F Protein, Human (His) is the recombinant human-derived animal-FreeIL-17F protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-17F Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-17f-protein-human-his.html
Purity
95.0
Smiles
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Molecular Formula
112744 (Gene_ID) Q96PD4 (R31-Q163) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Myelin oligodendrocyte glycoprotein (MOG) Human shRNA Lentiviral Particle (Locus ID 4340)
![Rat Monoclonal CD81 Antibody (431301) [Janelia Fluor 525]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
Rat Monoclonal CD81 Antibody (431301) [Janelia Fluor 525]