Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNG1 Rabbit Polyclonal Antibody (HRP)

KCNG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K13, kH2, KCNG, KV6.1

UniProt

Q9UIX4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VEGFR3/FLT4, C-His Tag
HA211107-01 20 µg

Human VEGFR3/FLT4, C-His Tag

Sign In for Pricing
View Details
Human VEGFR3/FLT4, C-His Tag
HA211107-02 50 µg

Human VEGFR3/FLT4, C-His Tag

Sign In for Pricing
View Details
Human VEGFR3/FLT4, C-His Tag
HA211107-03 100 µg

Human VEGFR3/FLT4, C-His Tag

Sign In for Pricing
View Details
MYH (MUTYH) Human Gene Knockout Kit (CRISPR)
KN401376 1 Kit

MYH (MUTYH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tide Fluor™ 3 azide [TF3 azide]
2254-AAT 1 mg

Tide Fluor™ 3 azide [TF3 azide]

Sign In for Pricing
View Details
GJA8 (C-term) Rabbit Polyclonal Antibody
AP11582PU-N 400 µL

GJA8 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details