Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnj3 Rabbit Polyclonal Antibody (HRP)

Kcnj3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GIR, Kcnf, Kir3, GIRK1, Kcnf3, Kcnj1, GIRK-1, Kir3.1

UniProt

P63250

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGRE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032452

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRODH Human Gene Knockout Kit (CRISPR)
KN420096 1 Kit

PRODH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-259-01 50 μL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-259-02 100 µL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-259-03 1 mL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
HBV Polyclonal Purified Antibody, Colloidal Gold Labeled,  10nm
GM-603-10 1 mL

HBV Polyclonal Purified Antibody, Colloidal Gold Labeled, 10nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Parotid gland
CS705780 5x 5 µm

Tissue FFPE Sections, Parotid gland

Sign In for Pricing
View Details