Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK3 Rabbit Polyclonal Antibody (HRP)

KCNK3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OAT1, PPH4, TASK, TASK1, TBAK1, K2p3.1, TASK-1

UniProt

O14649

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002237

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDGF-AA, Tag Free
HA211046-01 Inquire

Human PDGF-AA, Tag Free

Sign In for Pricing
View Details
Human PDGF-AA, Tag Free
HA211046-02 50 µg

Human PDGF-AA, Tag Free

Sign In for Pricing
View Details
Human PDGF-AA, Tag Free
HA211046-03 100 µg

Human PDGF-AA, Tag Free

Sign In for Pricing
View Details
MTA3 Rabbit Polyclonal Antibody
TA367719 100 µL

MTA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR 174 (GPR174) Human Gene Knockout Kit (CRISPR)
KN211205 1 Kit

GPR 174 (GPR174) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tenovin 6 Hydrochloride
TRC-T018475-5MG 5 mg

Tenovin 6 Hydrochloride

Sign In for Pricing
View Details