Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK3 Rabbit Polyclonal Antibody (HRP)

KCNK3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OAT1, PPH4, TASK, TASK1, TBAK1, K2p3.1, TASK-1

UniProt

O14649

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002237

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Over-expression Lysate
LC400060 20 µg

Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TASOR activation kit by CRISPRa
GA108181 1 Kit

Human TASOR activation kit by CRISPRa

Sign In for Pricing
View Details
PDE1A Rabbit Polyclonal Antibody
AP00651SU-N 100 µL

PDE1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
YTHDF1 Rabbit Polyclonal Antibody
TA367784 100 µL

YTHDF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Crygb (NM_144761) Mouse Tagged ORF Clone
MG201521 10 µg

Crygb (NM_144761) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
3Beta-Cholic Acid
TRC-C432605-5MG 5 mg

3Beta-Cholic Acid

Sign In for Pricing
View Details