Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNN2 Rabbit Polyclonal Antibody (FITC)

KCNN2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SK2, hSK2, SKCA2, KCa2.2, SKCa 2

UniProt

Q9H2S1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_067627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (MaxLight 550)
MBS6219722-01 0.1 mL

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (MaxLight 550)

Sign In for Pricing
View Details
TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (MaxLight 550)
MBS6219722-02 5x 0.1 mL

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (MaxLight 550)

Sign In for Pricing
View Details
MBTPS1
CSB-CL617930HU2 10 μg Plasmid + 200 μL Glycerol

MBTPS1

Sign In for Pricing
View Details
GALNT9, ID (GALNT9, Polypeptide N-acetylgalactosaminyltransferase 9, Polypeptide GalNAc transferase 9, Protein-UDP acetylgalactosaminyltransferase 9, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9) (PE) discontinued
035897-PE 200 µL

GALNT9, ID (GALNT9, Polypeptide N-acetylgalactosaminyltransferase 9, Polypeptide GalNAc transferase 9, Protein-UDP acetylgalactosaminyltransferase 9, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9) (PE) discontinued

Sign In for Pricing
View Details
POLR3F (DNA-directed RNA Polymerase III Subunit RPC6, RNA Polymerase III Subunit C6, DNA-directed RNA Polymerase III Subunit F, RNA Polymerase III 39kD Subunit, RPC39, Pol III RPC39) discontinued
225178-01 50 µL

POLR3F (DNA-directed RNA Polymerase III Subunit RPC6, RNA Polymerase III Subunit C6, DNA-directed RNA Polymerase III Subunit F, RNA Polymerase III 39kD Subunit, RPC39, Pol III RPC39) discontinued

Sign In for Pricing
View Details
POLR3F (DNA-directed RNA Polymerase III Subunit RPC6, RNA Polymerase III Subunit C6, DNA-directed RNA Polymerase III Subunit F, RNA Polymerase III 39kD Subunit, RPC39, Pol III RPC39) discontinued
225178-02 100 µL

POLR3F (DNA-directed RNA Polymerase III Subunit RPC6, RNA Polymerase III Subunit C6, DNA-directed RNA Polymerase III Subunit F, RNA Polymerase III 39kD Subunit, RPC39, Pol III RPC39) discontinued

Sign In for Pricing
View Details