Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNN2 Rabbit Polyclonal Antibody (HRP)

KCNN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SK2, hSK2, SKCA2, KCa2.2, SKCa 2

UniProt

Q9H2S1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_067627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINC1 (Antithrombin-III, AT3, ATIII, MGC22579, AT3D, THPH7) (PE)
MBS6437143-01 0.1 mL

SERPINC1 (Antithrombin-III, AT3, ATIII, MGC22579, AT3D, THPH7) (PE)

Sign In for Pricing
View Details
SERPINC1 (Antithrombin-III, AT3, ATIII, MGC22579, AT3D, THPH7) (PE)
MBS6437143-02 5x 0.1 mL

SERPINC1 (Antithrombin-III, AT3, ATIII, MGC22579, AT3D, THPH7) (PE)

Sign In for Pricing
View Details
Monkey Cyclic AMP responsive element binding protein 3 like protein 1 (CREB3L1) ELISA Kit
GTR10352658 96 Well

Monkey Cyclic AMP responsive element binding protein 3 like protein 1 (CREB3L1) ELISA Kit

Sign In for Pricing
View Details
PIWIL4 Double Nickase Plasmid (h2)
sc-404798-NIC-2 20 µg

PIWIL4 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Human C-C motif chemokine 2 ELISA Kit
MBS2883889-01 48 Well

Human C-C motif chemokine 2 ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 2 ELISA Kit
MBS2883889-02 96 Well

Human C-C motif chemokine 2 ELISA Kit

Sign In for Pricing
View Details