Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX7 Rabbit Polyclonal Antibody (FITC)

P2RX7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2X7

UniProt

Q99572

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human P2RX7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TIMP-2 Antibody (MM0035-2C13) [CoraFluor 1]
NB110-61001CL1 0.1 mL

Mouse Monoclonal TIMP-2 Antibody (MM0035-2C13) [CoraFluor 1]

Sign In for Pricing
View Details
Kiss1r (NM_053244) Mouse Tagged ORF Clone Lentiviral Particle
MR206203L2V 200 µL

Kiss1r (NM_053244) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCR3 (CCR3, C-C Chemokine Receptor Type 3, B-Chemokine Receptor, CD193, CD193 Antigen, Chemokine c-c motif Receptor 3, C-C Chemokine Receptor 3, CKR3, CC-CKR-3, CCR-3, CMKBR3, Eosinophil Eotaxin Receptor, Eotaxin Receptor, C-C CKR-3, CC Chemokine Receptor 3)
170252 50 µg

CCR3 (CCR3, C-C Chemokine Receptor Type 3, B-Chemokine Receptor, CD193, CD193 Antigen, Chemokine c-c motif Receptor 3, C-C Chemokine Receptor 3, CKR3, CC-CKR-3, CCR-3, CMKBR3, Eosinophil Eotaxin Receptor, Eotaxin Receptor, C-C CKR-3, CC Chemokine Receptor 3)

Sign In for Pricing
View Details
UQCR10 Antibody
DF15528-01 100 µL

UQCR10 Antibody

Sign In for Pricing
View Details
UQCR10 Antibody
DF15528-02 200 µL

UQCR10 Antibody

Sign In for Pricing
View Details
Recombinant Mouse ADAM8 Protein, His (Fc)-Avi-tagged
ADAM8-320M 50 µg

Recombinant Mouse ADAM8 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details