Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCNKA Rabbit Polyclonal Antibody (HRP)

CLCNKA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLCK1, ClC-K1, hClC-Ka

UniProt

P51800

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLCNKA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004061

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Influenza B Hemagglutinin 2 Antibody (InB18) [Janelia Fluor 646]
NB100-73163JF646 0.2 mL

Mouse Monoclonal Influenza B Hemagglutinin 2 Antibody (InB18) [Janelia Fluor 646]

Sign In for Pricing
View Details
beta 1 Sodium Potassium ATPase (ATP1B1) Rabbit Polyclonal Antibody
TA335283 100 µL

beta 1 Sodium Potassium ATPase (ATP1B1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAEL Polyclonal Antibody, Biotin Conjugated
A68267-050 50 µL

MAEL Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Pyrin (MEFV) Antibody
abx235109 100 µg

Pyrin (MEFV) Antibody

Sign In for Pricing
View Details
ALDH9A1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0072203 1.0 µg DNA

ALDH9A1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (011) [Alexa Fluor 488]
NBP2-89405AF488 0.1 mL

Rabbit Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (011) [Alexa Fluor 488]

Sign In for Pricing
View Details